Thymosin beta4

Thymosin beta4

$345.00

For laboratory research purposes only. Not for human or veterinary use.

CAS No: 77591-33-4

Purity:98%

Molar Mass: 4963.00

Chemical Formula: C212H350N56O78S

COA

Lead Time: In stock

CAT.NO: P100129

Categories: , ,

Size

  
  • Quantity
    • -
    • +
  •    
Inquiry
Description

Product Name: Thymosin beta4


Form: Acetate Salt


CAS No: 77591-33-4


Molar Mass: 4963.00


Chemical Formula: C212H350N56O78S


Synonyms: Timbetasin


Storage: Store at -20°C


Sequence: SDKPDMAEIE KFDKSKLKKT ETQEKNPLPS KETIEQEKQA GES


Target:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES


Purity: 98%


Application:


Thymosin beta-4 is a naturally occurring peptide that plays a vital role in cell migration, differentiation, and tissue repair. In pharmaceutical chemistry, thymosin beta-4 is studied for its potential therapeutic applications in promoting wound healing, tissue regeneration, and reducing inflammation. It acts by modulating various cellular processes involved in tissue repair, including promoting the migration of stem cells to injured sites, enhancing angiogenesis, and stimulating the production of extracellular matrix components. Additionally, thymosin beta-4 has shown promise in treating cardiovascular diseases, such as myocardial infarction, by improving cardiac function and reducing scar tissue formation. Its mechanism of action in promoting tissue repair and regeneration makes thymosin beta-4 a valuable candidate for developing treatments in regenerative medicine, cardiology, and wound care.


Current Research:


Thymosin beta-4 (TB4), a 43 amino acid peptide originally purified from the thymus, holds immense potential in reversing age-related alterations in the human body, particularly in the realm of tissue repair and regeneration. The quest to understand aging and to rejuvenate the body has been ongoing for centuries, with scientists exploring various molecular pathways responsible for cellular senescence and tissue damage. TB4 has emerged as a promising candidate in this pursuit, with its regenerative capabilities demonstrated in multiple organs, including the heart, brain, and kidneys.


Initially recognized for its role in sequestering actin monomers and altering cytoskeletal dynamics, TB4's capabilities extend far beyond actin regulation. Research has shown that TB4 inhibits cellular death by activating focal adhesion complex proteins, leading to the activation of Akt, a critical regulator of cell growth and survival. Moreover, TB4 activates protein kinase C (PKC), a key player in embryonic development, and upregulates vascular endothelial growth factor (VEGF), promoting vascular growth and cardiac function. By activating genes involved in embryonic development and maturation, TB4 effectively "rewinds time" in the heart, enhancing its regenerative capacity without risking injury.


Studies have highlighted TB4's potential in cardiac regeneration and repair, suggesting its ability to positively influence age-related changes in the adult human heart. The C-terminal variable domain of TB4 has been identified as a key contributor to its regenerative effects in the heart.


Despite significant progress, much remains to be discovered about TB4 and its mechanisms of action. However, researchers believe that TB4 is just one of many molecules waiting to be uncovered within the human body, offering hope for reversing age-related changes and overcoming one of humanity's greatest obstacles. With further exploration and understanding, TB4 and similar molecules hold the potential to fulfill the dream of reversing aging and improving human health and longevity.


Reference:


Faskerti, G., Gallyas Jr, F., … & Srivastava, D. (2023). Thymosin beta-4 denotes new directions towards developing prosperous anti-aging regenerative therapies. International Immunopharmacology, 116, 109741.


Choi, J., Cho, Y., Choi, H., Lee, S., Han, H., Lee, J., & Kwon, J. (2023). Thymosin beta 4 inhibits LPS and ATP-induced hepatic stellate cells via the regulation of multiple signaling pathways. International Journal of Molecular Sciences, 24(4), 3439.

Get a Quote

No products in the cart.