Thymosin beta4

Product Name: Thymosin beta4

Cas No: 77591-33-4

Application: THYMOSIN ß4 (Tß4) was first isolated from the calf thymosin fraction 5, which exhibited biologic activity on the immune system. A high concentration of Tß4 is found in granulocyte, mononuclear cells,and Epstein-Barr virus-transformed B cells.6 It was also found in various organs such as the spleen, thymus, liver, and others.

Molar Mass:4963 g/mol

Chemical Formula:C212H350N56O78S

Synonyms:Thymosin beta4 Acetate

Storage:Keep in dark place,Inert atmosphere,Store in freezer, under -20°C

Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Target Indicators: Thymosin beta 4 (TB-500) is a synthetic peptide that is derived from the naturally occurring Thymosin beta 4 protein.