Product Name: Thymosin beta4
Cas No: 77591-33-4
Application: THYMOSIN ß4 (Tß4) was first isolated from the calf thymosin fraction 5, which exhibited biologic activity on the immune system. A high concentration of Tß4 is found in granulocyte, mononuclear cells,and Epstein-Barr virus-transformed B cells.6 It was also found in various organs such as the spleen, thymus, liver, and others.
Molar Mass:4963 g/mol
Chemical Formula:C212H350N56O78S
Synonyms:Thymosin beta4 Acetate
Storage:Keep in dark place,Inert atmosphere,Store in freezer, under -20°C
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Target Indicators: Thymosin beta 4 (TB-500) is a synthetic peptide that is derived from the naturally occurring Thymosin beta 4 protein.