[Arg6]-beta-Amyloid (1-40), England Mutation

Product Name: [Arg6]-beta-Amyloid (1-40), England Mutation

Sequence One Letter Code: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

Cas No: 1802084-26-9

Chemical Formula:C194H300N54O58S

Molecular Weight: 4349.2

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: [Arg6]-β-Amyloid (1–40) is a mutant amyloid peptide containing the England mutation, in which histidine at position 6 is replaced by arginine. This autosomal dominant Alzheimer’s disease-associated mutation accelerates oligomer formation, promotes fibril seeding, and increases neurotoxicity compared with wild-type Aβ(1–40). The [Arg6] substitution alters charge distribution at the N-terminus, influencing aggregation kinetics and peptide–membrane interactions. This peptide is widely used in Alzheimer’s disease research to study mutation-specific amyloid toxicity, familial disease mechanisms, aggregation behavior, fibril formation, and molecular determinants of amyloid-related neurodegeneration.