[Asn23]-beta-amyloid (1-42), Iowa Mutation

Product Name: [Asn23]-beta-amyloid (1-42), Iowa Mutation

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Chemical Formula:C203H312N56O59S

Molecular Weight: 4513.4

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: [Asn23]-β-Amyloid (1–42) is a mutant amyloid peptide containing the Iowa mutation, in which aspartic acid at position 23 is replaced by asparagine. This mutation is associated with severe cerebral amyloid angiopathy and autosomal dominant Alzheimer’s disease. The altered residue enhances peptide aggregation, accelerates fibril formation, and increases vascular amyloid deposition and toxicity. [Asn23]-β-Amyloid (1–42) is widely used in neurodegeneration research to study mutation-driven amyloid pathology, structure–aggregation relationships, vascular amyloid mechanisms, cerebral amyloid angiopathy, and therapeutic strategies targeting familial Alzheimer’s disease-associated amyloid variants.