[Cys26]-beta-Amyloid (1-42)

Product Name: [Cys26]-beta-Amyloid (1-42)

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Cys-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Chemical Formula:C203H311N55O59S2

Molecular Weight: 4530.5

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: [Cys26]-Beta-Amyloid (1–42) is a mutant amyloid-β peptide in which serine at position 26 is replaced with cysteine. The introduced cysteine enables formation of covalently linked Aβ42 homodimers through disulfide bonding, providing a controlled model for studying amyloid dimerization. This dimeric state can be reversed under reducing conditions, allowing investigation of monomer–dimer equilibrium and early amyloid assembly events. [Cys26]-Beta-Amyloid (1–42) is widely used in Alzheimer’s disease research to study aggregation, oligomerization, neurotoxicity, pathogenic amyloid species, and mechanisms of amyloid-driven neurodegeneration.