GIP (1-42), human

Product Name: GIP (1-42), human

Sequence One Letter Code: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Sequence Three Letter Code: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

Cas No: 100040-31-1

Chemical Formula:C226H338N60O66S

Molecular Weight: 4983.9 Purity: ≥ 95% Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: Glucose-dependent Insulinotropic Polypeptide (GIP) is a 42-amino-acid incretin hormone released by intestinal K cells in response to nutrient intake. GIP plays a central role in postprandial metabolic regulation by stimulating glucose-dependent insulin secretion from pancreatic β-cells. It also supports β-cell survival, β-cell proliferation, lipid metabolism, and adipose tissue function. Acting through the GIP receptor, this peptide is widely used in studies of incretin biology, endocrine signaling, glucose homeostasis, obesity-related pathways, and metabolic disease mechanisms. GIP is an important research tool for investigating hormone-regulated insulin secretion and therapeutic targets in diabetes and metabolic syndrome.