Jingzhaotoxin III

Product Name:Jingzhaotoxin III

CAS No:925463-91-8

Purity:95%

Molar Mass:3919.45

Chemical Formula:C174H241N47O46S6

Storage:Store at -20 degrees Celsius

Sequence:DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP

Target:Nav1.5 Channels

Application:

Jingzhaotoxin III is a peptide toxin known for its selective inhibition of voltage-gated sodium channels (Nav), particularly Nav1.5, which is primarily expressed in cardiac tissue. By targeting Nav channels, Jingzhaotoxin III can modulate sodium ion flow, affecting the excitability of neurons and muscle cells. This makes it a valuable tool for studying the function of sodium channels in cardiac and neuronal tissues and for exploring potential therapeutic applications in cardiac arrhythmias and neurological disorders where sodium channel dysregulation is involved.

Current Research:

Jingzhaotoxin-III (JZTX-III) is a peptide toxin isolated from the venom of the Chinese tarantula Chilobrachys jingzhao. It functions as a potent and selective inhibitor of the voltage-gated sodium channel Nav1.5, which is predominantly expressed in cardiac myocytes.
Structural Characteristics
JZTX-III is composed of 36 amino acid residues, including six cysteines that form three disulfide bridges, resulting in a compact and stable structure. This configuration is characteristic of spider toxins that target ion channels.
Mechanism of Action
JZTX-III selectively inhibits the Nav1.5 channel by binding to the S3-S4 linker of domain II, thereby impeding channel activation. It exhibits an IC?? of approximately 348 nM for Nav1.5 and shows no significant effect on other sodium channel isoforms, such as Nav1.2, Nav1.4, Nav1.6, and Nav1.7.
Pharmacological Significance
By selectively targeting Nav1.5 channels, JZTX-III can modulate cardiac excitability, making it a valuable tool for studying cardiac electrophysiology and potential therapeutic interventions for cardiac arrhythmias. Its specificity allows for the discrimination of cardiac sodium channel subtypes without affecting neuronal channels.
Research Applications
JZTX-III is utilized in research to:
Investigate the role of Nav1.5 channels in cardiac function.
Explore the pathophysiology of cardiac arrhythmias.
Develop targeted therapies for cardiac disorders involving sodium channel dysfunction.
Conclusion
Jingzhaotoxin-III serves as a potent and selective inhibitor of the Nav1.5 sodium channel, offering significant utility in cardiac research and potential therapeutic applications.

Reference:

Xiao, Y., Tang, J., Yang, Y., Wang, M., Hu, W., Xie, J., ... & Liang, S. (2004). Jingzhaotoxin-III, a novel spider toxin inhibiting activation of voltage-gated sodium channel in rat cardiac myocytes. Journal of Biological Chemistry, 279(25), 26220-26226.