[Lys22]-beta-Amyloid (1-40), Italian Mutation

[Lys22]-β-Amyloid (1–40) is a pathogenic amyloid peptide variant carrying the Italian familial Alzheimer’s disease mutation, also known as E22K. Substitution of lysine for glutamic acid at position 22 accelerates aggregation and increases neurotoxicity compared with wild-type Aβ(1–40). The enhanced pathogenic behavior may be linked to formation of a stabilizing Lys22–Asp23 salt bridge. This peptide is widely used in neurodegeneration research to investigate amyloid fibril formation, toxic oligomer mechanisms, mutation-driven Alzheimer’s disease progression, plaque development, and therapeutic screening targeting abnormal amyloid aggregation.

Product Name: [Lys22]-beta-Amyloid (1-40), Italian Mutation

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

Cas No: 302905-01-7

Chemical Formula:C195H300N54O56S

Molecular Weight: 4329.2

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26