Product Name: Pancreastatin
Sequence One Letter Code: PEGKGEQEHSQQKEEEEEMAVVPQGLFRG-NH2
Sequence Three Letter Code: Pro-Glu-Gly-Lys-Gly-Glu-Gln-Glu-His-Ser-Gln-Gln-Lys-Glu-Glu-Glu-Glu-Glu-Met-Ala-Val-Val-Pro-Gln-Gly-Leu-Phe-Arg-Gly-NH2
Chemical Formula:C138H216N40O51S1
Molecular Weight: 3283.53
Purity: ≥ 95%
Form: Lyophilized
Storage Conditions: - 20 °C
Source / Species: human
Conjugation: Unconjugated
Application: Pancreastatin is an active peptide fragment derived from chromogranin A, with the 24–52 region representing a biologically relevant variant. It plays an important role in metabolic regulation by inhibiting glycogen synthesis and modulating glucose-stimulated insulin secretion. Pancreastatin also influences lipid and protein metabolism in adipose tissue and liver. This peptide is widely used in endocrine and metabolic research to study hormone-regulated energy balance, insulin resistance, glucose homeostasis, adipose tissue signaling, hepatic metabolism, and mechanisms contributing to metabolic dysfunction and type 2 diabetes-related pathways.
Get a Quote