CAT.NO: P200186
CAS No: 75976-10-2
Purity: 95%
Molar Mass: 4181.7
Chemical Formula: C185H287N53O54S2
Categories: Bioactive Peptides, Hormone & Metabolic Peptides, Hormone Receptor Ligands, Uncategorized
Product Name: Pancreatic Polypeptide (human)
CAS No: 75976-10-2
Purity: 95%
Molar Mass: 4181.7
Chemical Formula: C185H287N53O54S2
Storage: Store at -20 degrees Celsius
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Application:
Pancreatic Polypeptide (PP) is a peptide hormone secreted by the PP cells (F cells) of the pancreas in response to food intake. It regulates pancreatic enzyme secretion and gastrointestinal motility by binding to specific receptors in the brain and digestive organs. PP plays a critical role in maintaining energy balance and modulating appetite by influencing the hypothalamus. Its levels are altered in various conditions, including obesity, anorexia, and pancreatic disorders. Due to its regulatory functions, Pancreatic Polypeptide is a valuable biomarker in metabolic research and offers potential therapeutic applications in treating metabolic and eating disorders.
Current Research:
Pancreatic polypeptide (PP), a 36-amino-acid peptide hormone, is secreted by pancreatic F-cells in response to food intake. It plays a crucial role in regulating gastrointestinal motility, pancreatic secretions, and energy homeostasis. Belonging to the neuropeptide Y family, PP shares structural similarities with peptide YY (PYY) and neuropeptide Y (NPY), acting primarily through the Y4 receptor.
Physiological Roles and Mechanism
PP modulates the digestive system by inhibiting pancreatic exocrine secretion and slowing gastric emptying. It influences appetite regulation by signaling satiety to the brain, contributing to energy balance. These functions position PP as an essential regulator of digestive and metabolic processes.
Applications in Drug Discovery
Metabolic Disorders
PP has gained attention for its potential in addressing obesity and metabolic syndrome. By suppressing appetite and enhancing energy expenditure, PP receptor agonists are being explored as novel treatments for weight management and type 2 diabetes.
Gastrointestinal Research
PP’s regulatory effects on pancreatic and gastrointestinal activity make it a target in conditions such as pancreatitis and irritable bowel syndrome (IBS). Understanding its role in gut-brain communication could open pathways for therapeutic innovation.
Oncology
Elevated PP levels serve as biomarkers for pancreatic neuroendocrine tumors (PNETs), aiding in diagnosis and disease monitoring. Research is also exploring PP's involvement in tumor metabolism and progression.
Future Perspectives
Ongoing studies aim to optimize PP-based therapies by enhancing receptor selectivity and pharmacokinetics. Advances in peptide engineering are expected to improve the stability and delivery of PP analogs for therapeutic use.
For researchers, pancreatic polypeptide represents a valuable tool in understanding and treating metabolic, gastrointestinal, and oncological disorders, driving progress in peptide-based drug discovery.
Reference:
Get a Quote
Get a Quote
No products in the cart.