Adropin (34-76)

Product Name: Adropin (34-76)

Sequence One Letter Code: CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP-OH

Sequence Three Letter Code: Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH

Chemical Formula:C190H295N55O68S2

Molecular Weight: 4501.88

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: Human/Mouse/Rat

Conjugation: Unconjugated

Application: Adropin (34–76) is a peptide fragment derived from adropin, a secreted hormone encoded by the energy homeostasis-associated gene. Adropin is primarily expressed in the brain and liver and plays an important role in regulating lipid metabolism, glucose metabolism, insulin sensitivity, and systemic energy balance. It has been shown to improve metabolic profiles and exert beneficial effects in obesity models. Adropin (34–76) is widely used in metabolic and cardiovascular research to investigate nutrient sensing, obesity-related mechanisms, metabolic homeostasis, insulin signaling, vascular function, and endocrine pathways linking energy status to cardiometabolic regulation.