[Asn7]-beta-Amyloid (1-40), Tottori-Japan Mutation

Product Name: [Asn7]-beta-Amyloid (1-40), Tottori-Japan Mutation

Sequence One Letter Code: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH

Cas No: 1802086-32-3

Chemical Formula:C194H296N54O57S

Molecular Weight: 4329.2

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: [Asn7]-β-Amyloid (1–40) is a mutant amyloid peptide containing the Tottori-Japan mutation, also known as D7N, a pathogenic substitution associated with autosomal dominant Alzheimer’s disease. This mutation accelerates oligomer formation, enhances fibril seeding, and increases neurotoxicity compared with wild-type β-amyloid. [Asn7]-β-Amyloid (1–40) is widely used in Alzheimer’s disease research to study amyloid aggregation kinetics, toxic oligomer mechanisms, fibril formation, and structure–function relationships. This peptide provides a valuable model for investigating how specific amyloid mutations influence disease progression, neuronal vulnerability, and mutation-driven amyloid pathology.