Product Name: Beta-Amyloid (1-40)-Lys(Biotin)-NH2
Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Lys(Biotin)-NH2
Molecular Weight: 4683.6
Purity: ≥ 95%
Form: Lyophilized
Storage Conditions: - 20 °C
Source / Species: human
Conjugation: Conjugated
Conjugation Type: Biotins
Code Nacres: NA.26
Application: Biotin-Beta-Amyloid (1–40) is a synthetic amyloid-β peptide corresponding to residues 1–40 with a C-terminal biotin modification for affinity-based applications. Aβ(1–40) is one of the major C-terminal variants generated from amyloid precursor protein and is the predominant species found in cerebrovascular amyloid deposits. The biotin tag enables detection, immobilization, pull-down assays, and interaction studies. Biotin-Beta-Amyloid (1–40) is widely used in Alzheimer’s disease research to investigate amyloid aggregation, protein–protein interactions, receptor binding, clearance mechanisms, and molecular pathways underlying amyloid-associated neurodegeneration.
Get a Quote