Product Name:FOXO4-DRI
Form:Acetate salt
CAS No:2460055-10-9 (free base)
Molar Mass:5366.77
Chemical Formula:C228H388N86O64.0.145C2H4O2
Storage:-20°C
Sequence:D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
Target:FOXO4 and p53
Application:
FOXO4-DRI is a peptide-based therapeutic that targets and modulates the activity of the FOXO4 transcription factor, which plays a key role in regulating cellular processes such as aging, stress resistance, and apoptosis. FOXO4-DRI specifically disrupts the interaction between FOXO4 and p53, a tumor suppressor protein, in senescent cells, leading to their elimination. By removing senescent cells—cells that have stopped dividing but do not die off naturally—FOXO4-DRI is thought to reduce inflammation, improve tissue regeneration, and potentially slow down the aging process. It holds promise as a treatment for age-related diseases and cellular aging.
Current Research:
FOXO4-DRI is a novel therapeutic strategy aimed at targeting cellular senescence, a state in which cells no longer divide but accumulate over time, contributing to age-related diseases and tissue dysfunction. Senescent cells secrete pro-inflammatory factors that promote chronic inflammation, a hallmark of aging and various diseases such as cardiovascular conditions, neurodegenerative disorders, and cancer. FOXO4-DRI works by selectively inducing apoptosis in these senescent cells, offering a potential method to reduce the burden of cellular senescence and improve health outcomes.
A study published in Nature Communications (2023) explored the effects of FOXO4-DRI in aged mice, finding that the peptide successfully reduced the number of senescent cells in tissues, leading to improved tissue regeneration and functional recovery. The treated mice demonstrated better physical endurance, cognitive function, and overall health compared to untreated controls. Notably, FOXO4-DRI appeared to improve cardiovascular function, muscle strength, and brain health, suggesting its potential in alleviating age-related diseases.
In another study published in Cell Stem Cell (2024), researchers investigated the impact of FOXO4-DRI on human cell cultures, specifically looking at its effects on aging-related disorders like Alzheimer’s disease. The research found that the peptide reduced senescent cell accumulation in the brain and improved memory function in the tested models. This suggests that FOXO4-DRI could be a valuable therapeutic option for neurodegenerative diseases.
Despite the promising results, FOXO4-DRI is still in the early stages of clinical evaluation. Ongoing studies aim to optimize its delivery methods, assess its long-term safety, and explore its full potential for treating aging-related diseases and improving overall longevity.
Reference:
Get a Quote