GLP-1(7-37)

GLP-1(7-37)

CAT.NO: P200178

CAS No: 106612-94-6

Purity: 98%

Molar Mass: 3355.7

Chemical Formula: C151H228N40O47

Categories: , , ,

Inquiry
Description

Product Name: GLP-1(7-37)

Form: Acetate salt

CAS No: 106612-94-6

Molar Mass: 3355.7

Chemical Formula: C151H228N40O47

Synonyms: Glucagon-related peptide 1 (Rana catesbeiana), 3-L-glutamic acid-10-L-valine-16-glycine-17-L-glutamine-23-L-isoleucine-24-L-alanine-27-L-valine-31-glycine-32-de-L-lysine- (ZCI)

Storage: Store at -20 degrees Celsius

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Application:

GLP-1(7-37) is a potent incretin hormone essential for glucose homeostasis and appetite regulation. It binds to the GLP-1 receptor, stimulating insulin secretion and inhibiting glucagon release in a glucose-dependent manner. This peptide also slows gastric emptying and promotes satiety, making it a valuable therapeutic agent for type 2 diabetes and obesity management. Additionally, GLP-1(7-37) exhibits cardioprotective and neuroprotective effects, contributing to its potential in treating cardiovascular diseases and neurodegenerative disorders. Its multifaceted mechanism of action and therapeutic versatility make GLP-1(7-37) a critical component in advanced metabolic and pharmacological research.

Current Research:

GLP-1(7-37), a bioactive form of glucagon-like peptide-1, plays a pivotal role in regulating glucose homeostasis, making it a critical focus in drug discovery. As a potent incretin hormone, GLP-1(7-37) enhances insulin secretion, suppresses glucagon release, and delays gastric emptying, thus lowering postprandial glucose levels. Its therapeutic potential extends beyond glycemic control, encompassing applications in obesity, cardiovascular diseases, and neurodegenerative disorders. Current research on GLP-1(7-37) is driving innovation in drug discovery by unraveling its molecular mechanisms and receptor interactions. Structural and functional studies of GLP-1 receptor (GLP-1R) activation have provided insights into ligand-receptor dynamics, paving the way for designing receptor agonists with improved pharmacokinetic profiles. Advanced analytical tools, such as cryo-electron microscopy and molecular docking, are shedding light on GLP-1R conformational states, enabling rational drug design. In metabolic disease research, GLP-1(7-37) analogs and receptor modulators are being explored to improve glucose regulation while mitigating adverse effects such as nausea. Beyond diabetes, preclinical studies suggest GLP-1(7-37) derivatives exhibit neuroprotective properties, offering hope for therapeutic interventions in Alzheimer's and Parkinson's diseases. Moreover, cardiovascular research highlights GLP-1(7-37)'s role in improving endothelial function and reducing inflammation, positioning it as a candidate for managing heart failure and atherosclerosis. The ongoing development of dual and triple agonists targeting GLP-1R alongside other incretin pathways exemplifies the innovative approaches researchers are adopting. These multi-target therapies aim to maximize therapeutic efficacy by addressing metabolic and cardiovascular complications concurrently. For drug discovery scientists, GLP-1(7-37) remains a cornerstone of metabolic and multimodal therapeutic research. Its versatility in addressing complex disease pathways underscores its significance in the advancement of next-generation therapies.

Reference:

Burgmaier, M., Liberman, A., Möllmann, J., Kahles, F., Reith, S., Lebherz, C., … & Lehrke, M. (2013). Glucagon-like peptide-1 (GLP-1) and its split products GLP-1 (9-37) and GLP-1 (28-37) stabilize atherosclerotic lesions in apoe−/− mice. Atherosclerosis, 231(2), 427-435.

Get a Quote

No products in the cart.