[Lys22]-beta-Amyloid (1-42), Italian Mutation

Product Name: [Lys22]-beta-Amyloid (1-42), Italian Mutation

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Chemical Formula:C204H316N56O58S1

Molecular Weight: 4513.5

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: [Lys22]-β-Amyloid (1–42) is a synthetic Alzheimer’s disease-associated peptide variant carrying the Italian mutation E22K, identified in autosomal dominant familial cases. This substitution enhances aggregation kinetics and produces stronger neurotoxic effects than wild-type Aβ(1–42). Structural studies suggest that abnormal stabilization through a Lys22–Asp23 salt bridge may contribute to increased pathogenicity. [Lys22]-β-Amyloid (1–42) is widely used in Alzheimer’s disease and amyloid research to model mutation-dependent plaque formation, study toxic conformers, investigate neuronal injury, and screen therapeutic strategies targeting amyloid aggregation.