MT7 – Muscarinic Toxin 7

Product Name:MT7 - Muscarinic Toxin 7

Purity:95%

Molar Mass:7472.42

Chemical Formula:C322H484N90O98S9

Storage:Store at -20 degrees Celsius

Sequence:LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK

Target:muscarinic M1 receptor

Application:

MT7 (Muscarinic Toxin 7) is a peptide toxin derived from the venom of the green mamba snake (Dendroaspis angusticeps). It selectively targets the muscarinic acetylcholine receptor M1 (mAChR M1), inhibiting its function with high affinity. The M1 receptor is involved in modulating cognitive processes, neural excitability, and memory, making MT7 a valuable tool in neuroscience research. By binding specifically to the M1 receptor, MT7 helps researchers study the receptor's role in neurological and neuropsychiatric conditions, such as Alzheimer's disease and schizophrenia. MT7 is instrumental in exploring therapeutic strategies targeting M1 receptors for cognitive and neurological disorders.

Current Research:

Muscarinic Toxin 7 (MT7) is a peptide isolated from the venom of the African green mamba (Dendroaspis angusticeps). Comprising 65 amino acids, MT7 exhibits a three-finger fold structure characteristic of toxins that act at cholinergic synapses. Selectivity and Binding MT7 is a highly selective and potent antagonist of the M1 subtype of muscarinic acetylcholine receptors (mAChRs). It binds to these receptors with subnanomolar affinity, displaying approximately 10,000 times greater selectivity for M1 receptors over other muscarinic subtypes. Mechanism of Action MT7 interacts with the extracellular loops of the M1 receptor, particularly the second (ECL2) and third (ECL3) loops. This binding stabilizes the receptor in an inactive conformation, thereby inhibiting acetylcholine-mediated signaling. Research Applications Due to its high specificity, MT7 serves as a valuable tool in neuropharmacological research: Receptor Characterization: MT7 aids in identifying and studying M1 receptor expression in various tissues. Functional Studies: It facilitates the exploration of M1 receptor roles in physiological and pathological processes, including cognitive functions and neurological disorders. Therapeutic Potential The unique selectivity of MT7 for M1 receptors positions it as a potential lead compound for developing therapeutics targeting cognitive impairments, such as those observed in Alzheimer's disease. However, its application is currently limited to research settings. Conclusion Muscarinic Toxin 7 is a potent and selective antagonist of M1 muscarinic acetylcholine receptors, offering significant insights into cholinergic signaling and potential therapeutic avenues for related disorders. Its applications extend from fundamental research to the development of novel pharmacological agents.

Reference:

Kukkonen, A., Peräkylä, M., Åkerman, K. E., & Näsman, J. (2004). Muscarinic toxin 7 selectivity is dictated by extracellular receptor loops. Journal of Biological Chemistry, 279(49), 50923-50929.