Product Name: Neuropeptide Y (human, rat)
CAS No: 90880-35-6
Molar Mass: 4271.7
Chemical Formula: C189H285N55O57S
Storage: Store at -20??
Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Application:
Neuropeptide Y (NPY) is a highly conserved peptide neurotransmitter that plays a critical role in regulating various physiological processes, including appetite, circadian rhythms, and stress response. It exerts its effects by binding to Y receptors in the brain, modulating neurotransmitter release, and influencing energy balance. NPY is involved in promoting food intake, reducing anxiety, and enhancing memory retention. Its dysregulation has been linked to conditions such as obesity, anxiety disorders, and hypertension. Due to its broad physiological impact, NPY is a significant target for research in neurobiology, metabolic disorders, and psychiatric conditions.
Current Research:
Neuropeptide Y (NPY), a 36-amino-acid peptide conserved across species, including humans and rats, plays a crucial role in regulating diverse physiological and behavioral processes. As one of the most abundant peptides in the central and peripheral nervous systems, NPY interacts with a family of G protein-coupled receptors (Y1, Y2, Y4, Y5, and Y6), mediating its wide-ranging effects on appetite, stress response, cardiovascular function, and energy homeostasis. Key Research Applications Metabolic Disorders and Obesity NPY is a critical regulator of feeding behavior and energy balance, making it a target of interest in obesity and metabolic syndrome research. Activation of Y1 and Y5 receptors stimulates appetite and fat storage, while Y2 receptor agonists show promise in appetite suppression and weight reduction therapies. Understanding the NPY-receptor signaling pathways facilitates the development of novel anti-obesity drugs. Stress and Psychiatric Disorders In the central nervous system, NPY is involved in modulating stress resilience, anxiety, and depression. Elevated levels of NPY are associated with stress-coping mechanisms, while deficiencies may exacerbate anxiety and mood disorders. This makes NPY-based therapies a potential avenue for treating psychiatric conditions, particularly stress-induced disorders. Cardiovascular Research NPY's vasoconstrictive properties and involvement in sympathetic nervous system regulation make it a focus of cardiovascular studies. It contributes to blood pressure regulation and vascular remodeling, offering potential therapeutic insights into hypertension and atherosclerosis. Cancer Biology In oncology, NPY and its receptors are explored for their role in tumor growth and angiogenesis, particularly in breast, ovarian, and prostate cancers. Targeting NPY receptors may enable selective modulation of tumor microenvironments.
Reference: Gehlert, D. R. (2004). Introduction to the reviews on neuropeptide Y.?Neuropeptides,?38(4), 135-140.
Get a Quote