Nocistatin (human)

Nocistatin (human)

CAT.NO: P200282

CAS No:212609-11-5

Purity:95%

Molar Mass:3561.9

Chemical Formula:C149H238N42O53S3

Categories: , , ,

Inquiry
Description

Product Name:Nocistatin (human)

CAS No:212609-11-5

Purity:95%

Molar Mass:3561.9

Chemical Formula:C149H238N42O53S3

Storage:Store at -20 degrees Celsius

Sequence:MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ

Application:

Nocistatin (human) is a neuropeptide derived from the same precursor protein as nociceptin/orphanin FQ, but it exerts opposite effects. Nocistatin plays a significant role in modulating pain and sensory perception by inhibiting the nociceptive actions induced by nociceptin. Unlike nociceptin, which promotes pain transmission, nocistatin blocks this process, thereby reducing pain sensation. It is involved in various physiological functions, including the regulation of pain, stress responses, and immune functions. Due to its unique antagonistic properties, Nocistatin (human) is extensively studied in research focused on pain management, neurobiology, and potential therapeutic applications for conditions associated with chronic pain and inflammation.

Current Research:

Nocistatin is a 30-amino acid neuropeptide derived from the precursor protein prepronociceptin. It plays a crucial role in modulating pain and cognitive functions. Unlike nociceptin, which promotes pain transmission, nocistatin counteracts these effects, acting as an inhibitor of nociceptin-induced hyperalgesia and allodynia. Additionally, nocistatin is known to attenuate pain responses associated with inflammation, making it a significant regulator in the endogenous pain modulation system.
Nocistatin operates through distinct receptors separate from those utilized by nociceptin. Its binding to specific neuronal sites suggests the presence of unique nocistatin receptors, though the exact signaling pathways remain a subject of ongoing research. This specificity highlights its potential role in developing novel therapeutic strategies for pain management.
Beyond its impact on pain, nocistatin has been implicated in cognitive functions. Studies indicate that it can improve memory and learning deficits induced by nociceptin, providing insights into its broader physiological roles. Its ability to influence these processes without affecting motor activity underscores its importance in neurobiological research.
The discovery of nocistatin has broadened the understanding of the complex regulatory systems involved in pain and cognitive function. Its unique properties and mechanisms of action make it a promising target for innovative therapeutic approaches, particularly for conditions resistant to conventional pain and memory-related treatments. As research progresses, nocistatin continues to hold significant potential in advancing the field of neuroscience and clinical applications.

Reference:

Liu, E. H. C., Lee, T. L., Nishiuchi, Y., Kimura, T., & Tachibana, S. (2007). Nocistatin and its derivatives antagonize the impairment of short-term acquisition induced by nociceptin. Neuroscience letters, 416(2), 155-159.

Get a Quote

No products in the cart.