CAT.NO: P200480
Purity:95%
Molar Mass:4971.62
Chemical Formula:C225H342N62O64S
Categories: GLP-1 / Incretin Pathway Modulators, Metabolic & Endocrine Peptide Inhibitors, Peptide Inhibitors, Uncategorized
Product Name:[Pro3]-GIP (Mouse)
Purity:95%
Molar Mass:4971.62
Chemical Formula:C225H342N62O64S
Storage:Store at -20 degrees Celsius
Sequence:YAPGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Application:
[Pro3]-GIP (Mouse) is a modified analog of glucose-dependent insulinotropic polypeptide (GIP), similar to its rat counterpart, where proline is substituted at the third position. This modification converts it into an antagonist of the GIP receptor, effectively inhibiting GIP signaling. GIP plays a role in regulating insulin secretion and glucose metabolism. By blocking GIP receptor activity, [Pro3]-GIP (Mouse) is used in research to investigate the role of GIP in metabolic disorders, particularly in the context of obesity and type 2 diabetes. It serves as a tool to explore potential therapeutic approaches for controlling glucose levels and improving insulin sensitivity.
Current Research:
[Pro³]-GIP (Mouse) is a synthetic analog of gastric inhibitory polypeptide (GIP), a key hormone involved in regulating glucose metabolism and insulin secretion. This analog features a single amino acid substitution—proline replacing alanine at position 3—transforming GIP from a receptor agonist into a competitive antagonist. This modification enables [Pro³]-GIP to bind to GIP receptors (GIPR) without activating them, effectively inhibiting GIP-mediated signaling.
Mechanism of Action
[Pro³]-GIP antagonizes GIP receptors by occupying the receptor-binding site and preventing the activation of downstream pathways that enhance glucose-stimulated insulin secretion. This action makes [Pro³]-GIP an invaluable tool for exploring the physiological and pathological roles of GIP, particularly in the context of glucose regulation, energy homeostasis, and lipid metabolism. By disrupting GIP signaling, [Pro³]-GIP allows researchers to assess the hormone's contributions to pancreatic beta-cell function and metabolic disorders such as obesity and type 2 diabetes.
Research Applications
This peptide is extensively used in metabolic and endocrinology research to:
Investigate GIP Function: Evaluate the role of GIP in glucose and energy homeostasis.
Model Disease States: Explore GIP's involvement in the pathophysiology of obesity, insulin resistance, and diabetes.
Therapeutic Development: Serve as a template for designing GIP receptor antagonists as potential treatments for metabolic syndromes.
Conclusion
[Pro³]-GIP (Mouse) is a highly specific GIP receptor antagonist, offering researchers an effective tool for dissecting GIP’s physiological roles and its impact on metabolic health. Its ability to modulate GIP signaling positions it as a critical reagent in studying metabolic disorders and developing targeted therapies. This peptide continues to advance our understanding of glucose regulation and energy metabolism in preclinical research settings.
Reference:
Get a Quote
Get a Quote
No products in the cart.