Product Name: Tau peptide (337-368) (Repeat4 domain)
Sequence One Letter Code: VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Sequence Three Letter Code: Val-Glu-Val-Lys-Ser-Glu-Lys-Leu-Asp-Phe-Lys-Asp-Arg-Val-Gln-Ser-Lys-Ile-Gly-Ser-Leu-Asp-Asn-Ile-Thr-His-Val-Pro-Gly-Gly-Gly-Asn-OH
Chemical Formula:C150H248N44O50
Molecular Weight: 3467.86
Purity: ≥ 95%
Form: Lyophilized
Storage Conditions: - 20 °C
Source / Species: human
Conjugation: Unconjugated
Code Nacres: NA.26
Application: Tau Peptide (337–368) is a 32-amino-acid fragment derived from the Repeat 4 domain of the human tau protein. Tau is a microtubule-associated protein essential for neuronal stability, axonal transport, and cytoskeletal organization. Tau repeat domains are critical for microtubule binding and play central roles in tau aggregation, fibril formation, and neurodegenerative disease progression. Tau Peptide (337–368) is commonly used to study tau aggregation, repeat-domain structure, isoform-specific properties, tau–tau interactions, and structure–function relationships. It supports research into Alzheimer’s disease, tauopathies, aggregation inhibitors, and therapeutic development.
Get a Quote