Product Name: ADAMTS-13 FRET Substrate, FRETS-VWF73
Sequence One Letter Code: DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Sequence Three Letter Code: H-Asp-Arg-Glu-Dap(Nma)-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-Dap(Dnp)-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH
Molecular Weight: 8314.9
Purity: ≥ 95%
Form: Lyophilized
Storage Conditions: - 20 °C Protected from light
Source / Species: human
Conjugation: Conjugated
Conjugation Type: Spacers
Code Nacres: NA.26
Application: FRETS-VWF73 is a fluorescence-quenching peptide substrate specifically designed for von Willebrand factor-cleaving protease ADAMTS-13. Cleavage of this substrate produces a measurable fluorescence increase, enabling rapid and sensitive assessment of ADAMTS-13 enzymatic activity. ADAMTS-13 plays a critical role in hemostasis by processing von Willebrand factor, and its deficiency or dysfunction is closely associated with thrombotic thrombocytopenic purpura and related thrombotic microangiopathies. FRETS-VWF73 is widely used in thrombosis research, hemostasis studies, enzyme activity assays, diagnostic method development, and functional evaluation of ADAMTS-13 protease activity.
Get a Quote