Apelin-36 (human)

Product Name:Apelin-36 (human)

CAS No:252642-12-9

Purity:95%

Molar Mass:4195.87

Chemical Formula:C184H297N69O43S

Storage:Store at -20 degrees Celsius

Sequence:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Target:APJ receptor agonist

Application:

Apelin-36 (human) is a biologically active peptide derived from the apelin precursor, which binds to the APJ receptor. Apelin-36 is known for its involvement in various physiological processes, including cardiovascular regulation, fluid homeostasis, and energy metabolism. This longer form of the apelin peptide plays a key role in vasodilation, heart contractility, and angiogenesis, making it a valuable research tool for studying cardiovascular diseases, such as heart failure and hypertension. In addition to its cardiovascular effects, Apelin-36 has been studied in the context of metabolic disorders, inflammation, and neuroprotection, providing insights into therapeutic strategies targeting the apelin signaling pathway.

Current Research:

Apelin-36, a 36-amino acid peptide derived from the precursor preproapelin, is an endogenous ligand for the apelin receptor (APJ), a G protein-coupled receptor with critical roles in cardiovascular, metabolic, and central nervous system functions. Among the various isoforms of apelin, Apelin-36 exhibits unique biochemical properties, including a longer half-life and distinct receptor-binding dynamics, making it a focus of current biomedical research. In cardiovascular studies, Apelin-36 has been shown to regulate vascular tone, enhance myocardial contractility, and counteract pathological cardiac remodeling. It is particularly significant in conditions such as heart failure and hypertension, where apelinergic signaling is disrupted. Current research is investigating the peptide's therapeutic potential in reducing ischemia-reperfusion injury and its synergistic effects when combined with existing cardiovascular therapies. Apelin-36 also plays a role in metabolic regulation. Studies have demonstrated its involvement in glucose homeostasis, lipid metabolism, and insulin sensitivity, suggesting potential applications in managing metabolic syndromes such as type 2 diabetes and obesity. Ongoing research seeks to unravel the peptide's mechanistic pathways in energy balance and its therapeutic implications in metabolic disorders. Emerging evidence highlights Apelin-36's neuroprotective properties. It has been implicated in maintaining blood-brain barrier integrity and modulating neuroinflammatory responses. These findings have sparked interest in its potential for treating neurodegenerative diseases, including Alzheimer's disease and stroke. Additionally, its role in neurogenesis and synaptic plasticity is under exploration, broadening its relevance in central nervous system disorders. The pharmacokinetics and receptor-specific interactions of Apelin-36 are also active areas of investigation. These studies aim to optimize its therapeutic utility and minimize potential adverse effects, particularly in chronic treatment scenarios. As a multifunctional peptide, Apelin-36 continues to drive innovative research in physiology, pathology, and therapeutic development, making it a promising candidate for addressing complex diseases.

Reference:

Gu, Q., Zhai, L., Feng, X., Chen, J., Miao, Z., Ren, L., ... & Liu, C. F. (2013). Apelin-36, a potent peptide, protects against ischemic brain injury by activating the PI3K/Akt pathway. Neurochemistry international, 63(6), 535-540.