B-type Natriuretic Peptide, BNP-32, human

B-type Natriuretic Peptide, BNP-32, human

For laboratory research purposes only. Not for human or veterinary use.

Cas No: 114471-18-0

Purity: ≥ 95%

Chemical Formula: C143H244N50O42S4

CAT.NO: P400795

Categories: , ,

Inquiry
Description

Product Name: B-type Natriuretic Peptide, BNP-32, human

Sequence One Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)

Sequence Three Letter Code: H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: 10-26)

Cas No: 114471-18-0

Chemical Formula:C143H244N50O42S4

Molecular Weight: 3464.2

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: Human BNP-32 is a biologically active 32-amino-acid hormone produced primarily by ventricular cardiomyocytes in response to myocardial stretch and pressure overload. It is generated from a larger precursor through proteolytic processing that also yields NT-proBNP. BNP-32 counteracts renin–angiotensin–aldosterone system activity by promoting vasodilation, natriuresis, and reduced cardiac load. The peptide contains a conserved 17-amino-acid ring structure characteristic of natriuretic peptides. Human BNP-32 is widely used in cardiovascular physiology, heart failure research, endocrine signaling studies, blood pressure regulation, and investigations of cardiac stress and natriuretic peptide biology.

Get a Quote

No products in the cart.