Beta-Amyloid (1-34)

Product Name: Beta-Amyloid (1-34)

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-OH

Chemical Formula:C170H253N47O52

Molecular Weight: 3787.4

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: Beta-Amyloid (1–34) is a truncated amyloid-β peptide representing a minor, naturally produced Aβ species in the human brain. Although Aβ(1–40) and Aβ(1–42) are the dominant forms associated with Alzheimer’s disease pathology, shorter variants such as Aβ(1–34) arise through alternative enzymatic processing pathways. These truncated peptides may provide insight into amyloid metabolism, clearance, and peptide heterogeneity. Beta-Amyloid (1–34) is widely used in neurodegeneration research to study non-canonical Aβ species, amyloid processing, peptide clearance, aggregation behavior, and the biological significance of amyloid diversity in Alzheimer’s disease.