Beta-Amyloid (1-40)-Lys(Biotin-LC)

Product Name: Beta-Amyloid (1-40)-Lys(Biotin-LC)

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin-LC)

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Lys(Biotin-LC)-OH

Molecular Weight: 4797.8

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Conjugated

Conjugation Type: Biotins

Code Nacres: NA.26

Application: Biotin-LC-Beta-Amyloid (1–40) is a synthetic amyloid-β peptide corresponding to residues 1–40, with a biotin moiety attached at the C-terminus through a long-chain linker. Aβ(1–40) is a major amyloid species found in cerebrovascular deposits and plays an important role in Alzheimer’s disease pathology. The extended biotin linker improves accessibility for avidin- or streptavidin-based detection, capture, and immobilization assays. Biotin-LC-Beta-Amyloid (1–40) is commonly used in binding studies, pull-down assays, amyloid interaction analysis, aggregation research, clearance mechanism studies, and neurodegeneration assay development.