CRSP-1

Product Name:CRSP-1

CAS No:697327-12-1

Purity:95%

Molar Mass:4098.88

Chemical Formula:C175H294N54O49S5

Storage:Store at -20 degrees Celsius

Sequence:SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG

Target:central calcitonin

Application:CRSP-1 (Cardiovascular Regulator of Smooth Muscle Protein 1) is a peptide involved in the regulation of vascular smooth muscle cell function. It plays a role in the modulation of vascular tone and blood pressure by influencing smooth muscle contraction and relaxation. CRSP-1 is studied for its potential implications in cardiovascular diseases, including hypertension and atherosclerosis. Research into CRSP-1 focuses on its mechanisms of action in vascular smooth muscle cells and its potential as a therapeutic target for managing cardiovascular disorders and improving vascular health.

Current Research:

Calcitonin receptor-stimulating peptide-1 (CRSP-1), also known as calcitonin receptor-stimulating peptide, is a member of the calcitonin gene-related peptide family. It was initially isolated from porcine brain tissue and has been identified in various species, including humans. CRSP-1 exhibits significant biological activity, particularly in calcium homeostasis and bone metabolism.
Biological Activity
CRSP-1 functions as an endogenous agonist for the calcitonin receptor (CTR), stimulating cyclic adenosine monophosphate (cAMP) production with high potency. It has been shown to inhibit the formation and activity of osteoclasts, the cells responsible for bone resorption. This inhibition occurs through the suppression of multinucleated osteoclast formation and disruption of the actin ring structure essential for osteoclast function. The effects of CRSP-1 on osteoclasts are comparable to those of calcitonin, suggesting its potential role in bone metabolism regulation.
Physiological Roles
Administration of CRSP-1 in animal models leads to a transient decrease in plasma calcium levels, indicating its involvement in calcium homeostasis. The peptide achieves this by activating CTRs, which are expressed in various tissues, including bone and kidney. By modulating osteoclast activity, CRSP-1 contributes to the maintenance of bone density and overall skeletal health.
Research Applications
CRSP-1 serves as a valuable tool in biomedical research, particularly in:
Bone Metabolism Studies: Investigating the mechanisms underlying bone resorption and formation, and exploring potential therapeutic targets for osteoporosis and other metabolic bone diseases.
Calcium Homeostasis Research: Understanding the regulatory pathways involved in maintaining plasma calcium levels and the role of peptides like CRSP-1 in these processes.
Receptor Pharmacology: Elucidating the signaling pathways activated by CTRs and the physiological outcomes of their modulation by endogenous agonists such as CRSP-1.
Conclusion
CRSP-1 is a significant peptide in the regulation of bone metabolism and calcium homeostasis. Its ability to inhibit osteoclast formation and activity positions it as a potential therapeutic agent for conditions characterized by excessive bone resorption, such as osteoporosis. Ongoing research continues to uncover its mechanisms of action and broader physiological roles, contributing to the development of novel treatments for metabolic bone diseases.

Reference:

Notoya, M., Arai, R., Katafuchi, T., Minamino, N., & Hagiwara, H. (2007). A novel member of the calcitonin gene-related peptide family, calcitonin receptor-stimulating peptide, inhibits the formation and activity of osteoclasts. European journal of pharmacology, 560(2-3), 234-239.