HA Tag 3X

Product Name: HA Tag 3X

Sequence One Letter Code: MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE

Sequence Three Letter Code: H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH

Chemical Formula:C205H272N38O67S1

Molecular Weight: 4372.9

Purity: 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Research Area: Cancer Disease Research

Conjugation: Unconjugated

Code Nacres: NA.26

Application: HA Tag 3X is a synthetic peptide consisting of three tandem repeats of the hemagglutinin epitope sequence. The triple-repeat configuration increases antibody binding avidity and detection sensitivity compared with single HA tags. Recognized by widely used anti-HA monoclonal antibodies, HA Tag 3X facilitates immunoblotting, immunoprecipitation, immunofluorescence, and affinity purification applications. It is commonly fused to recombinant proteins to enable robust detection and localization analysis. This tag supports molecular biology, protein interaction studies, and signal transduction research requiring high-sensitivity immunodetection of tagged proteins.

Current Research: HA Tag 3X is a synthetic epitope tag composed of three tandem repeats of the influenza hemagglutinin (HA) epitope sequence, typically derived from the YPYDVPDYA motif. By arranging the epitope in a triple-repeat configuration, the 3X HA tag significantly enhances antibody binding avidity and detection sensitivity compared with a single HA tag. This amplification strategy improves performance across a broad range of immunodetection and purification applications, making HA Tag 3X a widely adopted tool in molecular and cellular biology. Epitope tagging enables detection of recombinant proteins using well-characterized monoclonal antibodies, eliminating the need to generate protein-specific antibodies for each construct. The HA epitope is one of the most extensively validated tags, with multiple high-affinity monoclonal antibodies—such as 12CA5 and related clones—available for research use. Incorporating three HA repeats increases the local epitope density on the tagged protein, thereby improving antibody binding strength through multivalent interactions. This enhanced avidity is particularly advantageous for detecting low-abundance proteins or proteins expressed under weak promoters. In immunoblotting (Western blot) applications, HA Tag 3X improves signal intensity and consistency. Proteins fused to a triple HA tag are more readily detected at lower expression levels, reducing the need for prolonged exposure times or high antibody concentrations. The stronger signal-to-noise ratio supports more accurate quantification and comparative analysis across experimental conditions. This feature is especially beneficial in studies of transient expression, inducible systems, or proteins with rapid turnover. Immunoprecipitation (IP) and co-immunoprecipitation (co-IP) assays also benefit from the 3X configuration. Increased antibody binding avidity enhances capture efficiency of tagged proteins from cell lysates, leading to improved recovery of protein complexes. This is critical when analyzing weak or transient protein–protein interactions. The 3X HA tag supports robust enrichment of target proteins for downstream applications such as mass spectrometry, enabling identification of interaction partners and signaling networks. In immunofluorescence and subcellular localization studies, HA Tag 3X improves detection sensitivity in fixed or permeabilized cells. The amplified epitope density facilitates strong binding of primary antibodies and efficient labeling with fluorescent secondary antibodies. This is particularly useful when studying proteins with low endogenous expression or dynamic localization patterns. Because the HA tag is relatively small even in triple-repeat form, it generally does not interfere significantly with protein folding or function when properly positioned at the N- or C-terminus. Affinity purification strategies also leverage the high-affinity interaction between HA epitopes and immobilized anti-HA antibodies. Triple tagging enhances binding stability during wash steps, improving purity and yield of isolated proteins. This supports structural studies, enzymatic assays, and biochemical characterization of recombinant proteins. The HA Tag 3X is compatible with diverse expression systems, including bacterial, yeast, insect, and mammalian cells. It is frequently incorporated into plasmid vectors for overexpression, CRISPR-mediated endogenous tagging, or viral transduction systems. In signal transduction research, triple HA tagging allows sensitive monitoring of kinases, receptors, adaptor proteins, and transcription factors under varying stimulation conditions. Overall, HA Tag 3X provides a high-sensitivity epitope tagging solution through tandem repetition of the HA motif. By enhancing antibody binding avidity and improving detection efficiency, it strengthens immunoblotting, immunoprecipitation, immunofluorescence, and purification workflows. Its reliability and versatility make it a valuable tool for protein expression analysis, interaction mapping, and mechanistic studies in molecular and cell biology research.