hBD-3, b-Defensin-3, human

Product Name: hBD-3, b-Defensin-3, human

Sequence One Letter Code: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)

Sequence Three Letter Code: H-Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys -OH (Disulfide bridge: 11-40, 18-33, 23-41)

Chemical Formula:C216H371N75O59S6

Molecular Weight: 5155.4

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: Human beta-defensin-3 (hBD-3) is a 45-amino-acid cysteine-rich antimicrobial peptide containing three intramolecular disulfide bonds and a strong cationic charge. Mainly expressed in keratinocytes and immune-associated tissues, hBD-3 provides broad-spectrum defense against bacteria, fungi, and viruses. Unlike many defensins, it retains potent antimicrobial activity under physiological salt conditions, making it especially relevant for infection-related research. Human beta-defensin-3 also modulates immune responses by stimulating cytokine production and promoting monocyte migration. This peptide is widely used in studies of innate immunity, antimicrobial mechanisms, host defense, inflammation, and immune regulation.