[Met]-beta-Amyloid (1-42), 5-TAMRA labeled

Product Name: [Met]-beta-Amyloid (1-42), 5-TAMRA labeled

Sequence One Letter Code: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Sequence Three Letter Code: 5-TAMRA-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Chemical Formula:C233H340N58O65S2

Molecular Weight: 5058.1

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C Protected from light

Source / Species: human

Conjugation: Conjugated

Conjugation Type: Fluorescent dyes

Code Nacres: NA.26

Application: 5-TAMRA Beta-Amyloid (1–42) is a fluorescently labeled amyloid-β peptide containing full-length Aβ(1–42) with an N-terminal methionine conjugated to 5-TAMRA. Aβ(1–42) is strongly associated with amyloid plaque formation and neurotoxicity in Alzheimer’s disease. The fluorescent label enables real-time visualization of peptide aggregation, cellular uptake, intracellular trafficking, and peptide–membrane interactions. 5-TAMRA Beta-Amyloid (1–42) is commonly used in fluorescence-based assays, imaging studies, aggregation kinetics, and screening platforms. This peptide supports research into amyloid pathology, neurodegeneration mechanisms, and therapeutic strategies targeting Aβ aggregation.