PEP1

PEP1

For laboratory research purposes only. Not for human or veterinary use.

Purity: 95%

Chemical Formula: C177H259N43O49S

CAT.NO: P400095

Categories: , ,

Inquiry
Description

Product Name: PEP1

Sequence One Letter Code: SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2

Sequence Three Letter Code: Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2

Chemical Formula:C177H259N43O49S

Molecular Weight: 3805.5

Purity: 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Research Area: Peptide Series

Source / Species: HCV

Conjugation: Unconjugated

Code Nacres: NA.26

Application: PEP1 is a synthetic peptide designed to mimic the amphipathic helix of hepatitis C virus NS5A, a structural motif essential for membrane association and replication complex formation. By competitively inhibiting NS5A membrane binding, PEP1 disrupts viral RNA replication processes. This peptide is used in virology research to investigate NS5A function, membrane-associated viral replication mechanisms, and host–virus interactions, supporting mechanistic studies and antiviral strategy development targeting NS5A.

Current Research: PEP1 is a synthetic peptide engineered to mimic the amphipathic α-helix of hepatitis C virus (HCV) NS5A, a structural element critical for viral membrane association and replication complex assembly. The N-terminal amphipathic helix of NS5A anchors the protein to endoplasmic reticulum–derived membranes, positioning the replication machinery at specialized membranous web structures required for efficient viral RNA synthesis. By structurally modeling this membrane-interacting domain, PEP1 functions as a competitive inhibitor of NS5A membrane binding, thereby disrupting formation and stability of the viral replication complex. Biological Context NS5A is a multifunctional nonstructural protein essential for HCV replication and assembly. It participates in: Anchoring replication complexes to intracellular membranes Coordinating RNA synthesis Interacting with host lipid metabolism pathways Modulating host antiviral responses The amphipathic helix at the N-terminus of NS5A contains hydrophobic and polar residues arranged to enable insertion into lipid bilayers. This membrane association is indispensable for replication complex integrity. Mechanism of Action PEP1 mimics the amphipathic helix structure and competes with native NS5A for membrane interaction sites. Its proposed mechanisms include: Displacement or interference with NS5A membrane anchoring Perturbation of replication complex assembly Disruption of lipid microdomain organization associated with viral replication By targeting a structural membrane-binding motif rather than enzymatic activity, PEP1 provides a mechanistic tool distinct from small-molecule NS5A inhibitors. Research Applications 1. NS5A Functional Analysis PEP1 is used to dissect the contribution of the amphipathic helix to viral RNA replication and replication complex formation. 2. Membrane Association Studies The peptide supports investigation of protein–lipid interactions, membrane curvature effects, and the structural determinants of NS5A membrane targeting. 3. Host–Virus Interaction Research NS5A interacts with host factors involved in lipid metabolism and vesicle trafficking. PEP1 can help delineate how membrane binding influences these interactions. 4. Antiviral Strategy Development As a structural mimic, PEP1 provides a model system for exploring alternative strategies that disrupt NS5A function via interference with membrane anchoring rather than enzymatic inhibition. Experimental Considerations Membrane interaction studies may require lipid vesicle systems, microsomal fractions, or cell-based replication assays. Peptide concentration should be optimized to achieve competitive effects without nonspecific membrane disruption. Controls using scrambled or mutated peptides are recommended to confirm sequence-dependent activity.

Get a Quote

No products in the cart.