[Pro19]-beta-Amyloid (1-42)

Product Name: [Pro19]-beta-Amyloid (1-42)

Sequence One Letter Code: DAEFRHDSGYEVHHQKLVPFAEDVGSNKGAIIGLMVGGVVIA

Sequence Three Letter Code: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Pro-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Chemical Formula:C199H309N55O60S1

Molecular Weight: 4464.4

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: [Pro19]-Beta-Amyloid (1–42) is a variant of full-length beta-amyloid (1–42) in which phenylalanine at position 19 is replaced with proline. This single amino acid substitution disrupts β-sheet formation and significantly inhibits amyloid fibril assembly. Because fibrillation of Aβ(1–42) is a central feature of Alzheimer’s disease pathology, [Pro19]-Beta-Amyloid (1–42) is valuable as a negative control and mechanistic probe. This peptide is widely used to study amyloid aggregation, structure–function relationships, β-sheet disruption, fibril formation mechanisms, and therapeutic strategies designed to prevent or modulate amyloid assembly.