Scrambled-beta-Amyloid (1-42)

Product Name: Scrambled-beta-Amyloid (1-42)

Sequence One Letter Code: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

Sequence Three Letter Code: H-Ala-Ile-Ala-Glu-Gly-Asp-Ser-His-Val-Leu-Lys-Glu-Gly-Ala-Tyr-Met-Glu-Ile-Phe-Asp-Val-Gln-Gly-His-Val-Phe-Gly-Gly-Lys-Ile-Phe-Arg-Val-Val-Asp-Leu-Gly-Ser-His-Asn-Val-Ala-OH

Cas No: 1678415-52-5

Chemical Formula:C203H311N55O60S

Molecular Weight: 4514.4

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: human

Conjugation: Unconjugated

Code Nacres: NA.26

Application: Scrambled-beta-Amyloid (1–42) is a sequence-randomized control peptide containing the same amino acid composition as native beta-amyloid (1–42) but lacking the original sequence order required for amyloid fibril formation. Unlike Aβ(1–42), this scrambled peptide does not readily aggregate or induce typical amyloid-associated neurotoxicity. It is commonly used as a negative control in amyloid aggregation, cytotoxicity, receptor binding, and protein interaction studies. Scrambled-beta-Amyloid (1–42) helps researchers distinguish sequence-dependent amyloid effects from nonspecific peptide activity in Alzheimer’s disease models and neurodegenerative disease research.