Lead Time: in stock(2-3 weeks for QC and delivery)
CAT.NO: P300025
Cas No:83930-13-6
Purity:95%
Molar Mass:5040
Chemical Formula:C215H358N72O66S
Categories: Bioactive Peptides, Growth Hormone–Related Peptide, Hormone & Metabolic Peptides, Uncategorized
Product Name:Somatorelin
Form:TFA salt
Purity:95%
Storage:-20oC
Cas No:83930-13-6
Molar Mass:5040
Chemical Formula:C215H358N72O66S
IUPAC Name:(4S)-4-[[2-[[(2S)-5-amino-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-amino-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]propanoyl]amino]-3-carboxypropanoyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-3-methylbutanoyl]amino]-4-methylpentanoyl]amino]acetyl]amino]-5-oxopentanoyl]amino]-4-methylpentanoyl]amino]-3-hydroxypropanoyl]amino]propanoyl]amino]-5-carbamimidamidopentanoyl]amino]hexanoyl]amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoyl]amino]-3-carboxypropanoyl]amino]-3-methylpentanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-hydroxypropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoyl]amino]acetyl]amino]-5-[[(2S)-1-[[(2S)-4-amino-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1,4-dioxobutan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
SMILES:CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC3=CC=C(C=C3)O)N
InChIKey:JAHCMOSSKRAPEL-IBFVROBCSA-N
InChI:InChI=1S/C215H358N72O66S/c1-24-106(15)166(285-174(318)112(21)251-193(337)145(91-163(309)310)270-173(317)109(18)249-175(319)119(218)86-115-49-53-117(293)54-50-115)208(352)278-142(87-114-39-27-26-28-40-114)200(344)287-168(113(22)292)209(353)279-144(90-157(225)301)199(343)283-150(99-291)204(348)274-141(88-116-51-55-118(294)56-52-116)197(341)261-126(47-37-78-243-214(235)236)181(325)260-122(42-30-32-73-217)192(336)284-165(105(13)14)206(350)277-137(82-101(5)6)178(322)247-95-160(304)253-129(58-65-152(220)296)185(329)272-140(85-104(11)12)196(340)282-147(96-288)202(346)252-111(20)172(316)256-124(45-35-76-241-212(231)232)180(324)259-121(41-29-31-72-216)184(328)271-139(84-103(9)10)195(339)273-138(83-102(7)8)194(338)266-133(61-68-155(223)299)190(334)276-146(92-164(311)312)201(345)286-167(107(16)25-2)207(351)268-135(71-80-354-23)191(335)281-148(97-289)203(347)262-127(48-38-79-244-215(237)238)182(326)264-131(59-66-153(221)297)187(331)263-128(57-64-151(219)295)177(321)246-94-159(303)254-130(62-69-161(305)306)186(330)280-149(98-290)205(349)275-143(89-156(224)300)198(342)267-132(60-67-154(222)298)188(332)265-134(63-70-162(307)308)189(333)258-120(43-33-74-239-210(227)228)176(320)245-93-158(302)248-108(17)170(314)255-123(44-34-75-240-211(229)230)179(323)250-110(19)171(315)257-125(46-36-77-242-213(233)234)183(327)269-136(169(226)313)81-100(3)4/h26-28,39-40,49-56,100-113,119-150,165-168,288-294H,24-25,29-38,41-48,57-99,216-218H2,1-23H3,(H2,219,295)(H2,220,296)(H2,221,297)(H2,222,298)(H2,223,299)(H2,224,300)(H2,225,301)(H2,226,313)(H,245,320)(H,246,321)(H,247,322)(H,248,302)(H,249,319)(H,250,323)(H,251,337)(H,252,346)(H,253,304)(H,254,303)(H,255,314)(H,256,316)(H,257,315)(H,258,333)(H,259,324)(H,260,325)(H,261,341)(H,262,347)(H,263,331)(H,264,326)(H,265,332)(H,266,338)(H,267,342)(H,268,351)(H,269,327)(H,270,317)(H,271,328)(H,272,329)(H,273,339)(H,274,348)(H,275,349)(H,276,334)(H,277,350)(H,278,352)(H,279,353)(H,280,330)(H,281,335)(H,282,340)(H,283,343)(H,284,336)(H,285,318)(H,286,345)(H,287,344)(H,305,306)(H,307,308)(H,309,310)(H,311,312)(H4,227,228,239)(H4,229,230,240)(H4,231,232,241)(H4,233,234,242)(H4,235,236,243)(H4,237,238,244)/t106-,107-,108-,109-,110-,111-,112-,113+,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,165-,166-,167-,168-/m0/s1
Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Application:Somatorelin, also known as growth hormone-releasing hormone (GHRH) or sermorelin, is a synthetic analog of endogenous GHRH that stimulates the pituitary gland to release growth hormone (GH). It is primarily used for diagnosing growth hormone deficiency (GHD) in children and adults by assessing pituitary function. Unlike direct GH therapy, Somatorelin promotes natural GH secretion, maintaining physiological hormone regulation. Beyond endocrinology, research explores its potential in anti-aging medicine, metabolic disorders, muscle wasting, and cognitive health. Its ability to enhance GH-IGF-1 axis activity makes it a promising candidate for neuroprotection, sarcopenia treatment, and metabolic syndrome management.
Current Research:Somatorelin, also known as growth hormone-releasing hormone (GHRH) analog, is a key regulator of growth hormone (GH) secretion from the pituitary gland. It has been widely studied for its applications in growth hormone deficiency (GHD) diagnosis, but emerging research is expanding its potential into aging, metabolic regulation, neuroprotection, and muscle preservation. Growth Hormone Deficiency (GHD) Diagnosis and Therapy Somatorelin is primarily used to assess pituitary GH secretion in suspected cases of GHD. Pediatric and adult GHD diagnosis: Somatorelin stimulation tests are used to evaluate GH secretion capacity, helping differentiate between primary and secondary GH deficiencies. Alternative to recombinant GH therapy: Unlike direct GH administration, Somatorelin stimulates natural GH pulsatility, reducing risks of GH overexposure and preserving physiological feedback mechanisms. Anti-Aging and Longevity Research GH levels naturally decline with age, leading to muscle loss, reduced metabolism, and decreased cognitive function. Somatorelin is being studied as a potential anti-aging intervention. Muscle preservation and sarcopenia prevention: GH plays a key role in muscle mass maintenance, and Somatorelin is being investigated for combating age-related muscle loss. Skin health and wound healing: GH is involved in collagen synthesis and tissue repair, making Somatorelin a potential candidate for skin rejuvenation and wound healing in elderly patients. Cognitive health and neuroprotection: Research suggests that GH and IGF-1 influence brain plasticity and memory, making Somatorelin a potential treatment for cognitive decline in aging and neurodegenerative diseases. Metabolic and Obesity Research Given its impact on lipid metabolism, glucose regulation, and energy balance, Somatorelin is being explored for metabolic disorder treatment. Obesity and fat metabolism: Studies indicate that GHRH stimulation enhances fat mobilization, helping reduce visceral fat and improve body composition. Insulin sensitivity and diabetes management: Somatorelin??s effects on GH-IGF-1 signaling may improve glucose homeostasis and help in type 2 diabetes prevention. Metabolic syndrome treatment: Research is investigating whether Somatorelin-induced GH release can mitigate metabolic syndrome risk factors, such as high cholesterol, hypertension, and insulin resistance. Neuroprotection and Cognitive Function GH and IGF-1 are essential for brain function, and Somatorelin is being explored for neurological applications. Alzheimer??s disease and neurodegeneration: Some studies suggest that Somatorelin-induced GH release may help protect neurons, enhance synaptic plasticity, and reduce beta-amyloid accumulation. Cognitive enhancement: Research indicates that GH supports memory formation and learning, making Somatorelin a possible cognitive enhancer in aging individuals. Muscle Wasting and Performance Enhancement Given its ability to stimulate GH and IGF-1 secretion, Somatorelin is being researched for muscle preservation and performance enhancement. Cachexia and chronic disease-related muscle loss: It is being studied as a therapy for muscle wasting in cancer, chronic kidney disease (CKD), and HIV-related cachexia. Sports medicine and recovery: Athletes and researchers are exploring Somatorelin??s role in muscle recovery, endurance, and injury prevention. Emerging Research Areas Bone health and osteoporosis prevention: Somatorelin is being explored as a bone-strengthening agent, given GH??s role in bone remodeling and density maintenance. Sleep regulation: GH release is closely linked to deep sleep cycles, and researchers are evaluating Somatorelin for improving sleep disorders, including insomnia and sleep apnea. Cardiovascular health: Some studies suggest that Somatorelin may support heart function by enhancing vascular repair and reducing inflammation. As research progresses, Somatorelin??s role is expanding beyond endocrinology, with promising applications in aging, metabolism, neurology, and muscle preservation.
Get a Quote
Get a Quote
No products in the cart.