Product Name: Ularitide
Form: Acetate salt
CAS No: 118812-69-4
Molar Mass: 3505.96
Chemical Formula: C145H234N52O44S3
Synonyms: Urodilatin
Storage: Store at -20℃
Sequence: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Target: renal receptors
Application:
Ularitide (CAS: 118812-69-4) is a synthetic form of urodilatin, a natriuretic peptide primarily synthesized in the kidney. It functions as a vasodilator and natriuretic hormone, playing a key role in regulating blood pressure and fluid balance in the body. Ularitide acts by stimulating guanylate cyclase receptors in the vascular smooth muscle and renal tubules, leading to increased cyclic guanosine monophosphate (cGMP) levels, which in turn promote vasodilation and natriuresis (excretion of sodium in urine). Due to its potent vasodilatory and diuretic effects, ularitide is being investigated for its potential therapeutic applications in conditions such as acute decompensated heart failure (ADHF). Clinical trials have shown promising results, demonstrating ularitide's ability to improve hemodynamic parameters, relieve symptoms, and reduce hospitalizations in patients with ADHF. Despite these positive findings, further research is needed to fully elucidate ularitide's mechanisms of action and optimize its clinical use in heart failure management.
Current Research:
Ularitide is a synthetic form of urodilatin, a naturally occurring peptide that plays a critical role in regulating fluid balance and vascular tone. Urodilatin is structurally similar to atrial natriuretic peptide (ANP) and functions as a natriuretic peptide involved in promoting vasodilation, natriuresis (sodium excretion), and diuresis (fluid excretion). Ularitide has been developed as a potential therapeutic for the management of acute heart failure (AHF), a condition in which the heart is unable to pump blood efficiently, leading to fluid retention, increased cardiac workload, and systemic congestion.
Mechanism of Action
Ularitide works by mimicking the effects of urodilatin, which is primarily produced in the kidneys. The peptide exerts its effects through the natriuretic peptide receptor A (NPRA), which is present in the kidneys, blood vessels, and heart. Upon binding to this receptor, ularitide activates several physiological pathways that lead to:
Vasodilation: Ularitide promotes relaxation of smooth muscle cells in blood vessels, resulting in vasodilation and a reduction in systemic vascular resistance. This helps decrease the workload on the heart by lowering blood pressure and improving blood flow.
Natriuresis and Diuresis: Ularitide enhances the excretion of sodium and water by the kidneys, leading to a reduction in fluid retention. This is particularly beneficial in patients with heart failure, who often experience fluid buildup in the lungs (pulmonary edema) and other tissues.
Inhibition of the Renin-Angiotensin-Aldosterone System (RAAS): Ularitide can suppress the activity of RAAS, a pathway that is often overactive in heart failure and contributes to fluid retention, vasoconstriction, and adverse remodeling of the heart and kidneys. By counteracting RAAS, ularitide helps restore a balance in fluid homeostasis and reduces the risk of further heart failure progression.
Overall, ularitide's actions help reduce symptoms of congestion, improve hemodynamic stability, and support the heart's ability to pump blood more effectively, making it an attractive option for managing acute episodes of heart failure.
Current Research and Development
Ularitide has been studied in multiple clinical trials, primarily focusing on its use in acute decompensated heart failure (ADHF). One of the key studies, the TRUE-AHF trial, evaluated the safety and efficacy of ularitide in patients with ADHF. The trial demonstrated that ularitide effectively reduced dyspnea (shortness of breath), a hallmark symptom of heart failure, and improved renal function by promoting natriuresis and diuresis. Ularitide was well-tolerated, with fewer adverse effects compared to traditional therapies like furosemide (a loop diuretic), which is commonly used in managing fluid retention in heart failure.
In addition to its effects on fluid balance, research has suggested that ularitide may also have benefits in improving cardiac remodeling and reducing the likelihood of hospital readmissions. These effects may be due to its ability to modulate endothelial function, reduce inflammation, and counteract adverse hormonal signals that contribute to heart failure progression.
Advantages Over Traditional Therapies
One of the primary advantages of ularitide is its ability to target the underlying mechanisms of fluid overload and vascular dysfunction in acute heart failure. Traditional treatments like diuretics (e.g., furosemide) and vasodilators (e.g., nitroglycerin) help alleviate symptoms of congestion and reduce blood pressure, but they often do not address the multifaceted pathophysiology of heart failure. Ularitide’s dual-action—promoting both vasodilation and natriuresis—provides a more comprehensive approach to managing acute heart failure, potentially leading to better patient outcomes.
Additionally, unlike diuretics, which can lead to electrolyte imbalances and renal dysfunction in some patients, ularitide’s effect on renal function is generally more balanced and may even improve kidney performance in heart failure patients, particularly in those who suffer from cardiorenal syndrome (a condition where heart failure and kidney failure occur together).
Safety and Tolerability
In clinical studies, ularitide has generally been well tolerated with a safety profile that compares favorably to conventional therapies. The most common adverse effects reported include hypotension (low blood pressure) and mild renal impairment, both of which are consistent with the expected pharmacological effects of the drug. Unlike some vasodilators, ularitide is not associated with significant risks of reflex tachycardia (an increase in heart rate in response to lowered blood pressure), which can limit the efficacy of other agents used to treat acute heart failure.
However, as with all vasodilators, blood pressure monitoring is recommended during treatment, especially in patients who are at risk for hypotension.
Future Directions
The future of ularitide lies in its potential to be used in combination therapy with other heart failure treatments, such as beta-blockers, ACE inhibitors, and SGLT2 inhibitors, which have become mainstays in heart failure management. Given its complementary effects on fluid balance, vascular tone, and renal function, ularitide may enhance the efficacy of these drugs, leading to better overall management of heart failure symptoms and improved long-term outcomes.
Ongoing studies are also investigating its role in treating chronic heart failure and heart failure with preserved ejection fraction (HFpEF), a subtype of heart failure that is particularly difficult to treat with conventional therapies. Its ability to promote vascular health and fluid balance may prove to be beneficial in these patients, who often face significant challenges in managing their condition.
Additionally, research into its use in acute kidney injury (AKI) and cardiorenal syndrome is expanding, as the dual effects of ularitide on both heart and kidney function make it an attractive candidate for treating these interconnected disorders.
Conclusion
Ularitide represents a promising new treatment option for patients with acute decompensated heart failure and potentially for other conditions associated with fluid overload and vascular dysfunction. With its ability to reduce congestion, improve renal function, and support hemodynamic stability, ularitide offers a more targeted and potentially more effective approach to heart failure management compared to traditional therapies. As research continues, it may become an integral part of the treatment landscape for heart failure and cardiorenal syndrome, providing patients with a novel option to improve their quality of life and reduce the risk of hospital readmission.
Reference:
Get a Quote