B-type Natriuretic Peptide, BNP-45 (51-95), rat

Rat BNP-45 is a peptide corresponding to the C-terminal 45-amino-acid region of the B-type natriuretic peptide prohormone and contains residues required for natriuretic peptide bioactivity. BNP plays a central role in cardiovascular homeostasis by promoting natriuresis, vasodilation, and inhibition of cardiac remodeling. Comparative sequence analyses show conserved proteolytic processing motifs across mammalian species, suggesting shared mechanisms for BNP maturation. Rat BNP-45 is widely used in cardiovascular research to study natriuretic peptide signaling, prohormone processing, blood pressure regulation, cardiac remodeling, and species-specific structure–function relationships.

Product Name: B-type Natriuretic Peptide, BNP-45 (51-95), rat

Sequence One Letter Code: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)

Sequence Three Letter Code: H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bridge:23-39)

Chemical Formula:C213H349N71O65S3

Molecular Weight: 5041

Cas No: 123337-89-3

Purity: ≥ 95%

Form: Lyophilized

Storage Conditions: - 20 °C

Source / Species: rat

Conjugation: Unconjugated

Code Nacres: NA.26