Bay 55-9837

Bay 55-9837

CAT.NO: P200199

CAS No: 463930-25-8

Purity: 95%

Molar Mass: 3742.3

Chemical Formula: C167H270N52O46

Categories: , , ,

Inquiry
Description

Product Name: Bay 55-9837

CAS No: 463930-25-8

Molar Mass: 3742.3

Chemical Formula: C167H270N52O46

Storage: Store at -20 degrees Celsius

Sequence: HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

Target: VPAC2

Purity: 95%

Application:

BAY 55-9837 is a synthetic peptide that acts as a selective agonist for the glucagon-like peptide-1 (GLP-1) receptor. It mimics the action of endogenous GLP-1, stimulating insulin secretion in a glucose-dependent manner while inhibiting glucagon release. This peptide also slows gastric emptying and promotes satiety, contributing to its potential in managing type 2 diabetes and obesity. By enhancing insulin sensitivity and preserving β-cell function, BAY 55-9837 offers therapeutic benefits for glucose control and metabolic health. Its targeted mechanism of action makes it a valuable candidate for diabetes research and potential clinical applications in metabolic disorders.

Current Research:

Bay 55-9837 is a synthetic peptide and potent agonist of the vasoactive intestinal peptide receptor 2 (VPAC₂), characterized by high selectivity and specificity. It effectively binds to VPAC₂ receptors with an EC₅₀ value of 0.4 nM, while demonstrating minimal activity on VPAC₁ and PAC₁ receptors. This selectivity makes it an essential tool for exploring VPAC₂ receptor functions in physiological and pathological contexts.

In metabolic research, Bay 55-9837 has been shown to enhance glucose-dependent insulin secretion, a crucial mechanism in managing type 2 diabetes mellitus. Studies in pancreatic islets reveal its potential to stimulate insulin release, offering promising therapeutic applications in metabolic disorders. Additionally, its selective activation of VPAC₂ receptors minimizes off-target effects, enhancing its therapeutic value.

The peptide also holds promise in antiviral research. Investigations indicate its ability to reduce viral replication, particularly in the context of HIV-1. Its activity in modulating immune responses suggests broader applications in antiviral strategies, potentially in combination with other receptor-targeting compounds.

Bay 55-9837's ability to precisely activate VPAC₂ receptors allows researchers to study the receptor’s role in various systems, including immune and nervous systems. Its applications span the study of inflammatory pathways, neuroprotection, and cellular signaling, contributing to advancements in drug discovery targeting these pathways.

As a selective and potent VPAC₂ agonist, Bay 55-9837 provides critical insights into receptor-mediated functions and holds potential for therapeutic developments in metabolic diseases, viral infections, and receptor-specific interventions. Ongoing research aims to further elucidate its pharmacological properties and optimize its clinical applications.

Reference:

Hadwen, J., MacKenzie, D., Shamim, F., Mongeon, K., Holcik, M., MacKenzie, A., & Farooq, F. (2014). VPAC2 receptor agonist BAY 55-9837 increases SMN protein levels and moderates disease phenotype in severe spinal muscular atrophy mouse models. Orphanet Journal of Rare Diseases, 9, 1-9.

Get a Quote

No products in the cart.