CAT.NO: P200491
CAS No:21215-62-3
Purity:95%
Molar Mass:3417.87
Chemical Formula:C151H226N40O45S3
Categories: Bioactive Peptides, Hormone & Metabolic Peptides, Hormone Receptor Ligands, Uncategorized
Product Name:Calcitonin (human)
CAS No:21215-62-3
Purity:95%
Molar Mass:3417.87
Chemical Formula:C151H226N40O45S3
Storage:Store at -20 degrees Celsius
Sequence:CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2
Application:
Calcitonin (human) is a peptide hormone that plays a crucial role in calcium and bone metabolism. It lowers blood calcium levels by inhibiting osteoclast activity in bones and increasing calcium excretion by the kidneys. Calcitonin is primarily used in the treatment of conditions like hypercalcemia, Paget's disease, and postmenopausal osteoporosis. Its role in regulating calcium makes it a significant research tool for studying metabolic bone diseases and other related conditions. With its high biological activity and specificity, Calcitonin (human) is widely employed in both clinical and experimental settings.
Current Research:
Calcitonin is a 32-amino-acid peptide hormone produced primarily by the parafollicular cells (C cells) of the thyroid gland in humans. It plays a critical role in calcium and phosphate homeostasis by regulating bone metabolism and renal calcium excretion.
Mechanism of Action
Calcitonin exerts its effects through the calcitonin receptor, a G protein-coupled receptor expressed on osteoclasts and in the kidneys. By binding to this receptor:
Inhibition of Bone Resorption: Calcitonin reduces the activity of osteoclasts, the cells responsible for bone breakdown, thereby decreasing calcium release into the bloodstream.
Enhancement of Renal Calcium Excretion: It promotes calcium and phosphate excretion in the kidneys by reducing tubular reabsorption, contributing to a decrease in blood calcium levels.
Physiological Role
Calcitonin counteracts the effects of parathyroid hormone (PTH), which raises blood calcium levels. Together, these hormones maintain a delicate balance of calcium concentration in the body. While calcitonin's role in calcium homeostasis is well-defined in some species, its physiological significance in humans appears to be less critical under normal conditions.
Therapeutic Applications
Human calcitonin and its synthetic analogs have been used in clinical practice for various conditions, including:
Osteoporosis: Calcitonin helps reduce bone resorption, improving bone density and reducing fracture risk.
Paget's Disease of Bone: It alleviates abnormal bone turnover associated with this condition.
Hypercalcemia: Calcitonin is used to lower dangerously high levels of calcium in the blood.
Research Applications
Calcitonin serves as a model hormone in research focused on bone metabolism, calcium signaling, and the development of new treatments for metabolic bone diseases.
Conclusion
Human calcitonin is a crucial hormone for calcium regulation and bone health. Its therapeutic and research applications continue to contribute to our understanding and treatment of metabolic disorders affecting bones and calcium balance.
Reference:
Get a Quote
Get a Quote
No products in the cart.