Lqq IV

Product Name:Lqq IV

Purity:95%

Molar Mass:7202

Storage:Store at -20 degrees Celsius

Sequence:GVRDAYIADDKNCVYTCGSNSYCNTECTKNGAESGYCQWLGKYGNACWCIKLPDKVPIRIPGKCR

Application:

Lqq IV is a bioactive peptide derived from the venom of the scorpion Leiurus quinquestriatus quinquestriatus. This peptide exhibits potent effects on ion channels, particularly influencing sodium and potassium channels, making it a valuable tool for neurophysiological studies. Lqq IV's specific interaction with ion channels provides insights into the mechanisms of action of scorpion venom and its potential therapeutic applications. It is widely used in research focused on understanding channelopathies and developing novel treatments for related neurological disorders. With its high purity and stability, Lqq IV is essential for advanced pharmacological and toxicological research.

Current Research:

Lqq IV, also known as Toxin IV, is a peptide neurotoxin isolated from the venom of the scorpion Leiurus quinquestriatus quinquestriatus. This toxin is classified as an α-scorpion toxin due to its specific action on voltage-gated sodium (Nav) channels. By binding to receptor site-3 on these channels, Lqq IV inhibits the inactivation process, leading to prolonged action potentials and increased neuronal excitability.

Structurally, Lqq IV comprises a sequence of amino acids stabilized by disulfide bridges, characteristic of scorpion α-toxins. Its primary structure has been determined through automated sequencing of the S-carboxymethylated derivative, revealing insights into its functional domains.

Functionally, Lqq IV exhibits varying toxicity across different species. Notably, it demonstrates significantly lower toxicity in insects compared to other scorpion α-toxins, with an LD₅₀ approximately 500 times higher than that of LqhαIT in cockroach models. This reduced efficacy suggests limited functional activity in insects, indicating a potential preference for mammalian Nav channels.

In research, Lqq IV serves as a valuable tool for studying the modulation of sodium channel inactivation and the resulting effects on neuronal signaling. Its selective binding to Nav channels provides insights into channel physiology and the development of therapeutic agents targeting sodium channel dysfunctions.

In summary, Lqq IV is a scorpion α-toxin that modulates Nav channel activity by inhibiting inactivation, leading to prolonged neuronal action potentials. Its structural and functional properties make it a significant subject of study in neurophysiology and toxinology.

Reference:

Fatani, A. J. (2010). Comparative study between peripherally and centrally acting sublethal and lethal doses of Leiurus quinquestriatus scorpion venom in rabbits: The usefulness of the sodium channel blocker lidocaine. Saudi pharmaceutical journal, 18(3), 137-151.