SARS-CoV-2 Spike receptor binding domain, RBD (395-430) – Lys(Biotin-LC)

Product Name: SARS-CoV-2 Spike receptor binding domain, RBD (395-430) - Lys(Biotin-LC)

Sequence One Letter Code: VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT-K(Biotin-LC)-NH2

Sequence Three Letter Code: H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-Lys(Biotin-LC)-NH2

Molecular Weight: 4530.4

Purity: ≥ 95% 

Storage Conditions: - 20 °C

Source / Species: SARS-CoV-2

Conjugation: Conjugated

Conjugation Type: Biotins

Code Nacres: NA.26

Application: SARS-CoV-2 Spike RBD (395–430)-Biotin-LC is a synthetic peptide spanning residues 395–430 of the SARS-CoV-2 spike receptor-binding domain. This RBD region is important for receptor engagement, antibody recognition, and immune response characterization. Based on RefSeq YP_009724390.1, the peptide is modified with C-terminal Biotin-LC to enable immobilization, affinity capture, and detection in binding assay platforms. SARS-CoV-2 Spike RBD (395–430)-Biotin-LC is widely used in epitope mapping, antibody screening, diagnostic assay development, spike protein structure studies, immune escape analysis, and SARS-CoV-2 receptor interaction research.