SARS-CoV-2 Spike receptor binding domain, RBD (395-430)

Product Name: SARS-CoV-2 Spike receptor binding domain, RBD (395-430)

Sequence One Letter Code: VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT

Sequence Three Letter Code: H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-OH

Molecular Weight: 4063.8

Purity: ≥ 95% 

Storage Conditions: - 20 °C

Source / Species: SARS-CoV-2

Conjugation: Unconjugated

Code Nacres: NA.26

Application: SARS-CoV-2 Spike RBD (395–430) is a synthetic peptide covering residues 395–430 within the spike receptor-binding domain, based on RefSeq YP_009724390.1. This region is associated with receptor engagement, spike protein structure, and immune recognition. The peptide is frequently used in antibody binding assays, structural studies, epitope mapping, and vaccine-related research. SARS-CoV-2 Spike RBD (395–430) provides a useful tool for investigating spike protein conformational features, neutralizing antibody targets, immune response profiles, and molecular interactions involved in SARS-CoV-2 viral entry and host receptor recognition.